Lineage for d1pp8u_ (1pp8 U:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307539Family a.4.5.44: 39 kda initiator binding protein, IBP39, N-terminal domain [101045] (1 protein)
    automatically mapped to Pfam PF10416
  6. 2307540Protein 39 kda initiator binding protein, IBP39, N-terminal domain [101046] (1 species)
  7. 2307541Species Trichomonas vaginalis [TaxId:5722] [101047] (2 PDB entries)
  8. 2307547Domain d1pp8u_: 1pp8 U: [94978]
    protein/DNA complex; complexed with so4

Details for d1pp8u_

PDB Entry: 1pp8 (more details), 3.05 Å

PDB Description: crystal structure of the T. vaginalis IBP39 Initiator binding domain (IBD) bound to the alpha-SCS Inr element
PDB Compounds: (U:) 39 kDa initiator binding protein

SCOPe Domain Sequences for d1pp8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pp8u_ a.4.5.44 (U:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]}
dsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswis
dtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftr

SCOPe Domain Coordinates for d1pp8u_:

Click to download the PDB-style file with coordinates for d1pp8u_.
(The format of our PDB-style files is described here.)

Timeline for d1pp8u_: