![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.44: 39 kda initiator binding protein, IBP39, N-terminal domain [101045] (1 protein) automatically mapped to Pfam PF10416 |
![]() | Protein 39 kda initiator binding protein, IBP39, N-terminal domain [101046] (1 species) |
![]() | Species Trichomonas vaginalis [TaxId:5722] [101047] (2 PDB entries) |
![]() | Domain d1pp8f_: 1pp8 F: [94974] protein/DNA complex; complexed with so4 |
PDB Entry: 1pp8 (more details), 3.05 Å
SCOPe Domain Sequences for d1pp8f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pp8f_ a.4.5.44 (F:) 39 kda initiator binding protein, IBP39, N-terminal domain {Trichomonas vaginalis [TaxId: 5722]} dsndleasftsrlppeivaalkrkssrdpnsrfprklhmlltylasnpqleeeiglswis dtefkmkkknvalvmgiklntlnvnlrdlafeqlqhdkggwtqwkrsgftrns
Timeline for d1pp8f_: