Lineage for d1pm6a_ (1pm6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696452Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 2696453Protein Excisionase Xis [89004] (1 species)
  7. 2696454Species Bacteriophage lambda [TaxId:10710] [89005] (5 PDB entries)
    Uniprot P03699 1-55
  8. 2696462Domain d1pm6a_: 1pm6 A: [94894]

Details for d1pm6a_

PDB Entry: 1pm6 (more details)

PDB Description: solution structure of full-length excisionase (xis) from bacteriophage hk022
PDB Compounds: (A:) Excisionase

SCOPe Domain Sequences for d1pm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm6a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda [TaxId: 10710]}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrpvtgsl
lkrirngkkaks

SCOPe Domain Coordinates for d1pm6a_:

Click to download the PDB-style file with coordinates for d1pm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1pm6a_: