PDB entry 1pm6

View 1pm6 on RCSB PDB site
Description: Solution Structure of Full-Length Excisionase (Xis) from Bacteriophage HK022
Class: gene regulation
Keywords: antiparallel beta-sheet, winged-helix, cis-trans-trans triproline, gene regulation
Deposited on 2003-06-10, released 2003-12-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-04-21, with a file datestamp of 2009-04-17.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Excisionase
  Species: Enterobacteria phage HK022 [TaxId:10742]
  Gene: Xis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P68927 (0-71)
    • engineered (27)
  Domains in SCOPe 2.08: d1pm6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1pm6A (A:)
  myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrpvtgsl
  lkrirngkkaks