Lineage for d1pm6a_ (1pm6 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352497Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 352498Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) (S)
  5. 352554Family a.6.1.7: Excisionase-like [46891] (2 proteins)
    kinked C-terminal helix
  6. 352555Protein Excisionase Xis [89004] (1 species)
  7. 352556Species Bacteriophage lambda [TaxId:10710] [89005] (2 PDB entries)
  8. 352557Domain d1pm6a_: 1pm6 A: [94894]
    mutant

Details for d1pm6a_

PDB Entry: 1pm6 (more details)

PDB Description: solution structure of full-length excisionase (xis) from bacteriophage hk022

SCOP Domain Sequences for d1pm6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm6a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrpvtgsl
lkrirngkkaks

SCOP Domain Coordinates for d1pm6a_:

Click to download the PDB-style file with coordinates for d1pm6a_.
(The format of our PDB-style files is described here.)

Timeline for d1pm6a_: