SCOPe 2.08: Domain d1pg7z1: 1pg7 Z:1-113

Lineage for d1pg7z1 (1pg7 Z:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (181 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1pg7z1: 1pg7 Z:1-113 [94688]
   Other proteins in same PDB: d1pg7h2, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z2
   part of Fab 6A6

Details for d1pg7z1

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (Z:) murine antibody 6A6 Fab fragment

SCOPe Domain Sequences for d1pg7z1:

Sequence; same for both SEQRES and ATOM records:

>d1pg7z1 b.1.1.1 (Z:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
evqlqqsgpelvkpgasvkisckasgysftghllnwvkqshgknlewiglvhphngaity
nqkfkdkatltvdrssttayielvrltsndsavyycaredfryhysmdywgqgtsvtvss

Timeline for d1pg7z1:

• d1pg7z1 first appeared in SCOP 1.67
  
• d1pg7z1 appears in SCOPe 2.07