SCOPe 2.08: Domain d1pg7h2: 1pg7 H:114-213

Lineage for d1pg7h2 (1pg7 H:114-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1pg7h2: 1pg7 H:114-213 [94675]
   Other proteins in same PDB: d1pg7h1, d1pg7i1, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7y1, d1pg7y2, d1pg7z1
   part of humanized Fab D3H44 against human tissue factor

Details for d1pg7h2

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (H:) humanized antibody D3H44

SCOPe Domain Sequences for d1pg7h2:

Sequence, based on SEQRES records:

>d1pg7h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d1pg7h2 b.1.1.2 (H:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d1pg7h2:

• d1pg7h2 first appeared in SCOP 1.67
  
• d1pg7h2 appears in SCOPe 2.07