Lineage for d1pg7m2 (1pg7 M:108-213)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2748802Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2748803Species Human (Homo sapiens) [TaxId:9606] [88569] (147 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 2748926Domain d1pg7m2: 1pg7 M:108-213 [94681]
    Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7m1, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z1, d1pg7z2
    part of humanized Fab D3H44 against human tissue factor

Details for d1pg7m2

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab
PDB Compounds: (M:) humanized antibody D3H44

SCOPe Domain Sequences for d1pg7m2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7m2 b.1.1.2 (M:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d1pg7m2:

Click to download the PDB-style file with coordinates for d1pg7m2.
(The format of our PDB-style files is described here.)

Timeline for d1pg7m2: