Lineage for d1pg7y1 (1pg7 Y:1-108)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin light chain lambda variable domain, VL-lambda [88534] (9 species)
    VL-lambda domains of human antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the human genome; mouse VL-lambda domains belong to a single germline family
  7. Species Mouse (Mus musculus) [TaxId:10090] [88541] (36 PDB entries)
  8. Domain d1pg7y1: 1pg7 Y:1-108 [94686]
    Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w2, d1pg7x1, d1pg7x2, d1pg7y2, d1pg7z1, d1pg7z2
    part of Fab 6A6

Details for d1pg7y1

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab
PDB Compounds: (Y:) murine antibody 6A6 Fab fragment

SCOPe Domain Sequences for d1pg7y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7y1 b.1.1.1 (Y:1-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qavvtqesaltsspgetvtltcrsstgavttsnyanwvqekpdhlftgviggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlg

SCOPe Domain Coordinates for d1pg7y1 are not available.

Timeline for d1pg7y1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pg7y2
View in 3D
Domains from other chains:
(mouse over for more information)
d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7x2, d1pg7z1, d1pg7z2