Lineage for d1pd0a4 (1pd0 A:754-926)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2534201Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2534494Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family) (S)
  5. 2534495Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 protein domains)
  6. 2534502Protein Sec24 [82758] (1 species)
  7. 2534503Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82759] (4 PDB entries)
  8. 2534505Domain d1pd0a4: 1pd0 A:754-926 [94505]
    Other proteins in same PDB: d1pd0a1, d1pd0a2, d1pd0a3, d1pd0a5
    complexed with a snare peptide
    complexed with zn

Details for d1pd0a4

PDB Entry: 1pd0 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)
PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pd0a4:

Sequence, based on SEQRES records: (download)

>d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdvyslhdmadeaglpvqtedgeatgtivlpqpinatsslferyglylidngnelflwmg
gdavpalvfdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyi
vrgaslsepvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk

Sequence, based on observed residues (ATOM records): (download)

>d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdvyslhdmadeaglpvgtivlpqpinatsslferyglylidngnelflwmggdavpalv
fdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyivrgaarev
atlrlwasstlvedkilnnesyreflqimkarisk

SCOPe Domain Coordinates for d1pd0a4:

Click to download the PDB-style file with coordinates for d1pd0a4.
(The format of our PDB-style files is described here.)

Timeline for d1pd0a4: