SCOPe 2.08: Domain d1pd0a4: 1pd0 A:754-926

Lineage for d1pd0a4 (1pd0 A:754-926)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.109: Gelsolin-like [55752] (3 superfamilies)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.109.2: C-terminal, gelsolin-like domain of Sec23/24 [82754] (1 family)

5. Family d.109.2.1: C-terminal, gelsolin-like domain of Sec23/24 [82755] (2 proteins)

6. Protein Sec24 [82758] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82759] (4 PDB entries)

8. Domain d1pd0a4: 1pd0 A:754-926 [94505]
   Other proteins in same PDB: d1pd0a1, d1pd0a2, d1pd0a3, d1pd0a5
   complexed with a snare peptide
   complexed with zn

Details for d1pd0a4

PDB Entry: 1pd0, 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)

PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pd0a4:

Sequence, based on SEQRES records:

>d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdvyslhdmadeaglpvqtedgeatgtivlpqpinatsslferyglylidngnelflwmg
gdavpalvfdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyi
vrgaslsepvnhasarevatlrlwasstlvedkilnnesyreflqimkarisk

Sequence, based on observed residues (ATOM records):

>d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pdvyslhdmadeaglpvgtivlpqpinatsslferyglylidngnelflwmggdavpalv
fdvfgtqdifdipigkqeipvvensefnqrvrniinqlrnhddvityqslyivrgaarev
atlrlwasstlvedkilnnesyreflqimkarisk

Timeline for d1pd0a4:

• d1pd0a4 first appeared in SCOP 1.67
  
• d1pd0a4 appears in SCOPe 2.07