Class a: All alpha proteins [46456] (290 folds) |
Fold a.71: ERP29 C domain-like [47932] (2 superfamilies) 5 helices; bundle |
Superfamily a.71.2: Helical domain of Sec23/24 [81811] (1 family) automatically mapped to Pfam PF04815 |
Family a.71.2.1: Helical domain of Sec23/24 [81812] (2 proteins) |
Protein Sec24 [81815] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81816] (4 PDB entries) |
Domain d1pd0a1: 1pd0 A:647-753 [94502] Other proteins in same PDB: d1pd0a2, d1pd0a3, d1pd0a4, d1pd0a5 complexed with a snare peptide complexed with zn |
PDB Entry: 1pd0 (more details), 2.6 Å
SCOPe Domain Sequences for d1pd0a1:
Sequence, based on SEQRES records: (download)
>d1pd0a1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivvsntaggaplrlcan lrmfpllmhsltkhmafrsgivpsdhrasalnnleslplkylikniy
>d1pd0a1 a.71.2.1 (A:647-753) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} dqlaiasfynskavekalnsslddarvlinksvqdilatykkeivggaplrlcanlrmfp llmhsltkhmafrsgivpsdhrasalnnleslplkylikniy
Timeline for d1pd0a1:
View in 3D Domains from same chain: (mouse over for more information) d1pd0a2, d1pd0a3, d1pd0a4, d1pd0a5 |