Lineage for d1pd0a3 (1pd0 A:301-552)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892432Family c.62.1.2: Trunk domain of Sec23/24 [82458] (2 proteins)
    automatically mapped to Pfam PF04811
  6. 2892439Protein Sec24 [82461] (1 species)
  7. 2892440Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82462] (4 PDB entries)
  8. 2892442Domain d1pd0a3: 1pd0 A:301-552 [94504]
    Other proteins in same PDB: d1pd0a1, d1pd0a2, d1pd0a4, d1pd0a5
    complexed with a snare peptide
    complexed with zn

Details for d1pd0a3

PDB Entry: 1pd0 (more details), 2.6 Å

PDB Description: Crystal structure of the COPII coat subunit, Sec24, complexed with a peptide from the SNARE protein Sed5 (yeast syntaxin-5)
PDB Compounds: (A:) protein transport protein SEC24

SCOPe Domain Sequences for d1pd0a3:

Sequence, based on SEQRES records: (download)

>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldsenneesadqinmmdiadleepflprpnsmvvslkacrqnietlltkipqifqsnlit
nfalgpalksayhliggvggkiivvsgtlpnlgigklqrrnesgvvntsketaqllscqd
sfyknftidcskvqitvdlflasedymdvaslsnlsrftagqthfypgfsgknpndivkf
stefakhismdf

Sequence, based on observed residues (ATOM records): (download)

>d1pd0a3 c.62.1.2 (A:301-552) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pppatycflidvsqssiksgllattintllqnldsipnhdertrisilcvdnaihyfkip
ldseninmmdiadleepnsmvvslkacrqnietlltkipqifqsnlitnfalgpalksay
hliggvggkiivvsgtlpnlgigklqrdsfyknftidcskvqitvdlflasedymdvasl
snlsrftagqthfypgfsgknpndivkfstefakhismdf

SCOPe Domain Coordinates for d1pd0a3:

Click to download the PDB-style file with coordinates for d1pd0a3.
(The format of our PDB-style files is described here.)

Timeline for d1pd0a3: