Lineage for d1pc2a_ (1pc2 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922477Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 922478Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 922509Protein Mitochondria fission protein Fis1 [101417] (2 species)
  7. 922515Species Human (Homo sapiens) [TaxId:9606] [101418] (2 PDB entries)
  8. 922517Domain d1pc2a_: 1pc2 A: [94427]

Details for d1pc2a_

PDB Entry: 1pc2 (more details)

PDB Description: solution structure of human mitochondria fission protein fis1
PDB Compounds: (A:) mitochondria fission protein

SCOPe Domain Sequences for d1pc2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pc2a_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}
meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrskynddirkgivllee
llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
dglvgmaivggmalgvaglagliglehhhhhh

SCOPe Domain Coordinates for d1pc2a_:

Click to download the PDB-style file with coordinates for d1pc2a_.
(The format of our PDB-style files is described here.)

Timeline for d1pc2a_: