PDB entry 1pc2

View 1pc2 on RCSB PDB site
Description: Solution structure of human mitochondria fission protein Fis1
Class: unknown function
Keywords: Mitochondria, Fission, UNKNOWN FUNCTION
Deposited on 2003-05-15, released 2003-12-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondria fission protein
    Species: Homo sapiens [TaxId:9606]
    Gene: Fis1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9Y3D6 (0-144)
      • expression tag (145-151)
    Domains in SCOPe 2.01: d1pc2a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1pc2A (A:)
    meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrskynddirkgivllee
    llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
    dglvgmaivggmalgvaglagliglehhhhhh