SCOPe 2.02: Domain d1pc2a_: 1pc2 A:

Lineage for d1pc2a_ (1pc2 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (9 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (18 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein Mitochondria fission protein Fis1 [101417] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101418] (2 PDB entries)

8. Domain d1pc2a_: 1pc2 A: [94427]

Details for d1pc2a_

PDB Entry: 1pc2

PDB Description: solution structure of human mitochondria fission protein fis1

PDB Compounds: (A:) mitochondria fission protein

SCOPe Domain Sequences for d1pc2a_:

Sequence; same for both SEQRES and ATOM records:

>d1pc2a_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}
meavlnelvsvedllkfekkfqsekaagsvskstqfeyawclvrskynddirkgivllee
llpkgskeeqrdyvfylavgnyrlkeyekalkyvrgllqtepqnnqakelerlidkamkk
dglvgmaivggmalgvaglagliglehhhhhh

Timeline for d1pc2a_:

• d1pc2a_ first appeared in SCOP 1.67
  
• d1pc2a_ appears in SCOPe 2.01
  
• d1pc2a_ appears in SCOPe 2.03
  
• d1pc2a_ appears in the current release, SCOPe 2.08, called d1pc2a1