Lineage for d1p7ma_ (1p7m A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006171Fold a.96: DNA-glycosylase [48149] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2006172Superfamily a.96.1: DNA-glycosylase [48150] (7 families) (S)
  5. 2006284Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
    automatically mapped to Pfam PF03352
  6. 2006285Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)
  7. 2006286Species Escherichia coli [TaxId:562] [74758] (3 PDB entries)
  8. 2006289Domain d1p7ma_: 1p7m A: [94307]
    protein/DNA complex; complexed with adk, zn

Details for d1p7ma_

PDB Entry: 1p7m (more details)

PDB Description: solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i
PDB Compounds: (A:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d1p7ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p7ma_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]}
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp

SCOPe Domain Coordinates for d1p7ma_:

Click to download the PDB-style file with coordinates for d1p7ma_.
(The format of our PDB-style files is described here.)

Timeline for d1p7ma_: