SCOPe 2.05: Domain d1p7ma_: 1p7m A:

Lineage for d1p7ma_ (1p7m A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.96: DNA-glycosylase [48149] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.96.1: DNA-glycosylase [48150] (7 families)

5. Family a.96.1.4: 3-Methyladenine DNA glycosylase I (Tag) [74756] (1 protein)
   automatically mapped to Pfam PF03352

6. Protein 3-Methyladenine DNA glycosylase I (Tag) [74757] (2 species)

7. Species Escherichia coli [TaxId:562] [74758] (3 PDB entries)

8. Domain d1p7ma_: 1p7m A: [94307]
   protein/DNA complex; complexed with adk, zn

Details for d1p7ma_

PDB Entry: 1p7m

PDB Description: solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine dna glycosylase i

PDB Compounds: (A:) DNA-3-methyladenine glycosylase I

SCOPe Domain Sequences for d1p7ma_:

Sequence; same for both SEQRES and ATOM records:

>d1p7ma_ a.96.1.4 (A:) 3-Methyladenine DNA glycosylase I (Tag) {Escherichia coli [TaxId: 562]}
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp

Timeline for d1p7ma_:

• d1p7ma_ first appeared in SCOP 1.67
  
• d1p7ma_ appears in SCOPe 2.04
  
• d1p7ma_ appears in SCOPe 2.06
  
• d1p7ma_ appears in the current release, SCOPe 2.08