PDB entry 1p7m

View 1p7m on RCSB PDB site
Description: solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I
Class: hydrolase
Keywords: 3-methyladenine TAG complex nmr, HYDROLASE
Deposited on 2003-05-02, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-3-methyladenine glycosylase I
    Species: Escherichia coli [TaxId:562]
    Gene: TAG OR B3549
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05100 (0-186)
      • conflict (125)
      • conflict (181)
    Domains in SCOPe 2.06: d1p7ma_
  • Heterogens: ZN, ADK

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1p7mA (A:)
mercgwvsqdplyiayhdnewgvpetdskklfemiclegqqaglswitvlkkrenyracf
hqfdpvkvaamqeedverlvqdagiirhrgkiqaiignaraylqmeqngepfadfvwsfv
nhqpqmtqattlseiptstpasdalskalkkrgfkfvgtticysfmqacglvndhvvgcc
cypgnkp