SCOP 1.67: Domain d1p65a_: 1p65 A:

Lineage for d1p65a_ (1p65 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.254: Arterivirus nucleocapsid protein [103067] (1 superfamily)
   dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta

4. Superfamily d.254.1: Arterivirus nucleocapsid protein [103068] (1 family)

5. Family d.254.1.1: Arterivirus nucleocapsid protein [103069] (1 protein)

6. Protein Arterivirus nucleocapsid protein [103070] (1 species)

7. Species PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId:28344] [103071] (1 PDB entry)

8. Domain d1p65a_: 1p65 A: [94156]

Details for d1p65a_

PDB Entry: 1p65, 2.6 Å

PDB Description: Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (PRRSV)

SCOP Domain Sequences for d1p65a_:

Sequence; same for both SEQRES and ATOM records:

>d1p65a_ d.254.1.1 (A:) Arterivirus nucleocapsid protein {PRRSV (Porcine reproductive and respiratory syndrome virus)}
dvrhhftpserqlclssiqtafnqgagtctlsdsgrisytvefslpthhtvrlirvt

Timeline for d1p65a_:

• d1p65a_ is new in SCOP 1.67
  
• d1p65a_ appears in SCOP 1.69
  
• d1p65a_ appears in the current release, SCOPe 2.08