| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.254: Arterivirus nucleocapsid protein [103067] (1 superfamily) dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta |
Superfamily d.254.1: Arterivirus nucleocapsid protein [103068] (1 family) ![]() |
| Family d.254.1.1: Arterivirus nucleocapsid protein [103069] (1 protein) |
| Protein Arterivirus nucleocapsid protein [103070] (1 species) |
| Species PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId:28344] [103071] (1 PDB entry) |
| Domain d1p65b_: 1p65 B: [94157] |
PDB Entry: 1p65 (more details), 2.6 Å
SCOP Domain Sequences for d1p65b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p65b_ d.254.1.1 (B:) Arterivirus nucleocapsid protein {PRRSV (Porcine reproductive and respiratory syndrome virus)}
dvrhhftpserqlclssiqtafnqgagtctlsdsgrisytvefslpthhtvrlirvt
Timeline for d1p65b_: