Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily) dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta |
Superfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (3 families) |
Family d.254.1.1: Arterivirus nucleocapsid protein [103069] (1 protein) automatically mapped to Pfam PF01481 |
Protein Arterivirus nucleocapsid protein [103070] (2 species) |
Species PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId:28344] [103071] (1 PDB entry) |
Domain d1p65a_: 1p65 A: [94156] |
PDB Entry: 1p65 (more details), 2.6 Å
SCOPe Domain Sequences for d1p65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p65a_ d.254.1.1 (A:) Arterivirus nucleocapsid protein {PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId: 28344]} dvrhhftpserqlclssiqtafnqgagtctlsdsgrisytvefslpthhtvrlirvt
Timeline for d1p65a_: