Lineage for d1p65a_ (1p65 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 516755Fold d.254: Arterivirus nucleocapsid protein [103067] (1 superfamily)
    dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/beta
  4. 516756Superfamily d.254.1: Arterivirus nucleocapsid protein [103068] (1 family) (S)
  5. 516757Family d.254.1.1: Arterivirus nucleocapsid protein [103069] (1 protein)
  6. 516758Protein Arterivirus nucleocapsid protein [103070] (1 species)
  7. 516759Species PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId:28344] [103071] (1 PDB entry)
  8. 516760Domain d1p65a_: 1p65 A: [94156]

Details for d1p65a_

PDB Entry: 1p65 (more details), 2.6 Å

PDB Description: Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (PRRSV)

SCOP Domain Sequences for d1p65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p65a_ d.254.1.1 (A:) Arterivirus nucleocapsid protein {PRRSV (Porcine reproductive and respiratory syndrome virus)}
dvrhhftpserqlclssiqtafnqgagtctlsdsgrisytvefslpthhtvrlirvt

SCOP Domain Coordinates for d1p65a_:

Click to download the PDB-style file with coordinates for d1p65a_.
(The format of our PDB-style files is described here.)

Timeline for d1p65a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1p65b_