Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) contains a small beta-sheet (wing) |
Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein) |
Protein N-terminal domain of Bacillus PurR [101022] (1 species) |
Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries) |
Domain d1p4ad1: 1p4a D:2-74 [94096] Other proteins in same PDB: d1p4aa2, d1p4ab2, d1p4ac2, d1p4ad2 |
PDB Entry: 1p4a (more details), 2.22 Å
SCOP Domain Sequences for d1p4ad1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p4ad1 a.4.5.40 (D:2-74) N-terminal domain of Bacillus PurR {Bacillus subtilis} kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt vpgaaggvkyipk
Timeline for d1p4ad1: