SCOP 1.69: Domain d1p4ad1: 1p4a D:2-74

Lineage for d1p4ad1 (1p4a D:2-74)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)

6. Protein N-terminal domain of Bacillus PurR [101022] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101023] (2 PDB entries)

8. Domain d1p4ad1: 1p4a D:2-74 [94096]
   Other proteins in same PDB: d1p4aa2, d1p4ab2, d1p4ac2, d1p4ad2

Details for d1p4ad1

PDB Entry: 1p4a, 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP

SCOP Domain Sequences for d1p4ad1:

Sequence; same for both SEQRES and ATOM records:

>d1p4ad1 a.4.5.40 (D:2-74) N-terminal domain of Bacillus PurR {Bacillus subtilis}
kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
vpgaaggvkyipk

Timeline for d1p4ad1:

• d1p4ad1 first appeared in SCOP 1.67
  
• d1p4ad1 appears in SCOP 1.71
  
• d1p4ad1 appears in the current release, SCOPe 2.08