Lineage for d1p4ad2 (1p4a D:75-273)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489867Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 489868Superfamily c.61.1: PRTase-like [53271] (2 families) (S)
  5. 489869Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins)
  6. 490000Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species)
  7. 490001Species Bacillus subtilis [TaxId:1423] [102540] (2 PDB entries)
  8. 490009Domain d1p4ad2: 1p4a D:75-273 [94097]
    Other proteins in same PDB: d1p4aa1, d1p4ab1, d1p4ac1, d1p4ad1

Details for d1p4ad2

PDB Entry: 1p4a (more details), 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP

SCOP Domain Sequences for d1p4ad2:

Sequence, based on SEQRES records: (download)

>d1p4ad2 c.61.1.1 (D:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk
tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst
inmkeksieiqngnflrff

Sequence, based on observed residues (ATOM records): (download)

>d1p4ad2 c.61.1.1 (D:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdegstvsinyvsgssnriqtmslakrsmktgsn
vliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinmk
eksieiqngnflrff

SCOP Domain Coordinates for d1p4ad2:

Click to download the PDB-style file with coordinates for d1p4ad2.
(The format of our PDB-style files is described here.)

Timeline for d1p4ad2: