![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (2 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins) |
![]() | Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102540] (2 PDB entries) |
![]() | Domain d1p4ac2: 1p4a C:75-273 [94095] Other proteins in same PDB: d1p4aa1, d1p4ab1, d1p4ac1, d1p4ad1 |
PDB Entry: 1p4a (more details), 2.22 Å
SCOP Domain Sequences for d1p4ac2:
Sequence, based on SEQRES records: (download)
>d1p4ac2 c.61.1.1 (C:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis} mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst inmkeksieiqngnflrff
>d1p4ac2 c.61.1.1 (C:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis} mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv mtvatkgiplayaaasylnvpvvivrkdnegstvsinyvsgssnriqtmslakrsmktgs nvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinm keksieiqngnflrff
Timeline for d1p4ac2: