SCOP 1.69: Domain d1p4ab2: 1p4a B:75-273

Lineage for d1p4ab2 (1p4a B:75-273)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (11 proteins)

6. Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102540] (2 PDB entries)

8. Domain d1p4ab2: 1p4a B:75-273 [94093]
   Other proteins in same PDB: d1p4aa1, d1p4ab1, d1p4ac1, d1p4ad1

Details for d1p4ab2

PDB Entry: 1p4a, 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP

SCOP Domain Sequences for d1p4ab2:

Sequence, based on SEQRES records:

>d1p4ab2 c.61.1.1 (B:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk
tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst
inmkeksieiqngnflrff

Sequence, based on observed residues (ATOM records):

>d1p4ab2 c.61.1.1 (B:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis}
mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv
mtvatkgiplayaaasylnvpvvivrkdegstvsinyvsgssnriqtmslakrsmktgsn
vliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinmk
eksieiqngnflrff

Timeline for d1p4ab2:

• d1p4ab2 first appeared in SCOP 1.67
  
• d1p4ab2 appears in SCOP 1.71
  
• d1p4ab2 appears in the current release, SCOPe 2.08