SCOPe 2.08: Domain d1p4ab1: 1p4a B:2-74

Lineage for d1p4ab1 (1p4a B:2-74)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.40: N-terminal domain of Bacillus PurR [101021] (1 protein)
   automatically mapped to Pfam PF09182

6. Protein N-terminal domain of Bacillus PurR [101022] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [101023] (3 PDB entries)

8. Domain d1p4ab1: 1p4a B:2-74 [94092]
   Other proteins in same PDB: d1p4aa2, d1p4ab2, d1p4ac2, d1p4ad2
   complexed with pcp

Details for d1p4ab1

PDB Entry: 1p4a, 2.22 Å

PDB Description: Crystal Structure of the PurR complexed with cPRPP

PDB Compounds: (B:) pur operon repressor

SCOPe Domain Sequences for d1p4ab1:

Sequence; same for both SEQRES and ATOM records:

>d1p4ab1 a.4.5.40 (B:2-74) N-terminal domain of Bacillus PurR {Bacillus subtilis [TaxId: 1423]}
kfrrsgrlvdltnyllthphelipltffseryesakssisedltiikqtfeqqgigtllt
vpgaaggvkyipk

Timeline for d1p4ab1:

• d1p4ab1 first appeared in SCOP 1.67
  
• d1p4ab1 appears in SCOPe 2.07