![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein Pur operon repressor (PurR), C-terminal domain [102539] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102540] (3 PDB entries) |
![]() | Domain d1p4ab2: 1p4a B:75-273 [94093] Other proteins in same PDB: d1p4aa1, d1p4ab1, d1p4ac1, d1p4ad1 complexed with pcp |
PDB Entry: 1p4a (more details), 2.22 Å
SCOPe Domain Sequences for d1p4ab2:
Sequence, based on SEQRES records: (download)
>d1p4ab2 c.61.1.1 (B:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv mtvatkgiplayaaasylnvpvvivrkdnkvtegstvsinyvsgssnriqtmslakrsmk tgsnvliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlst inmkeksieiqngnflrff
>d1p4ab2 c.61.1.1 (B:75-273) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} mkqaeaeefvqtlgqslanperilpggyvyltdilgkpsvlskvgklfasvfaereidvv mtvatkgiplayaaasylnvpvvivrkdegstvsinyvsgssnriqtmslakrsmktgsn vliiddfmkaggtingminlldefnanvagigvlveaegvderlvdeymslltlstinmk eksieiqngnflrff
Timeline for d1p4ab2: