![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.2: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57774] (2 families) ![]() automatically mapped to Pfam PF05191 |
![]() | Family g.41.2.1: Microbial and mitochondrial ADK, insert 'zinc finger' domain [57775] (1 protein) |
![]() | Protein Microbial and mitochondrial ADK, insert 'zinc finger' domain [57776] (9 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [103618] (1 PDB entry) |
![]() | Domain d1p3ja2: 1p3j A:126-160 [94023] Other proteins in same PDB: d1p3ja1 complexed with ap5, mg, zn |
PDB Entry: 1p3j (more details), 1.9 Å
SCOPe Domain Sequences for d1p3ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3ja2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert 'zinc finger' domain {Bacillus subtilis [TaxId: 1423]} grricsvcgttyhlvfnppktpgicdkdggelyqr
Timeline for d1p3ja2: