|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (4 families)  | 
|  | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones | 
|  | Protein Histone H3 [47122] (5 species) | 
|  | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (38 PDB entries) | 
|  | Domain d1p3ie_: 1p3i E: [94018] Other proteins in same PDB: d1p3ib_, d1p3ic_, d1p3id_, d1p3if_, d1p3ig_, d1p3ih_ protein/DNA complex; mutant | 
PDB Entry: 1p3i (more details), 2.3 Å
SCOPe Domain Sequences for d1p3ie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3ie_ a.22.1.1 (E:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
tgeskkphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavma
lqeaseaylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d1p3ie_: