| Class a: All alpha proteins [46456] (284 folds) | 
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones  | 
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]()  | 
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones  | 
| Protein Histone H2B [47119] (6 species) | 
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (26 PDB entries) | 
| Domain d1p3id_: 1p3i D: [94017] Other proteins in same PDB: d1p3ia_, d1p3ib_, d1p3ic_, d1p3ie_, d1p3if_, d1p3ig_ protein/DNA complex; mutant  | 
PDB Entry: 1p3i (more details), 2.3 Å
SCOPe Domain Sequences for d1p3id_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3id_ a.22.1.1 (D:) Histone H2B {African clawed frog (Xenopus laevis) [TaxId: 8355]}
ksrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d1p3id_: