SCOPe 2.08: Domain d1oypb1: 1oyp B:1-151

Lineage for d1oypb1 (1oyp B:1-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 proteins)

6. Protein Ribonuclease PH, domain 1 [102758] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)

8. Domain d1oypb1: 1oyp B:1-151 [93736]
   Other proteins in same PDB: d1oypa2, d1oypb2, d1oypc2, d1oypd2, d1oype2, d1oypf2
   complexed with so4

Details for d1oypb1

PDB Entry: 1oyp, 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

PDB Compounds: (B:) Ribonuclease PH

SCOPe Domain Sequences for d1oypb1:

Sequence, based on SEQRES records:

>d1oypb1 d.14.1.4 (B:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

Sequence, based on observed residues (ATOM records):

>d1oypb1 d.14.1.4 (B:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlsgrtmeiqrligralravvdleklgertiwidcdviqadggtrtasitgaflam
aiaigklikagtik

Timeline for d1oypb1:

• d1oypb1 first appeared in SCOP 1.67
  
• d1oypb1 appears in SCOPe 2.07