Lineage for d1oypb1 (1oyp B:1-151)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2157367Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2157368Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2157612Family d.14.1.4: Ribonuclease PH domain 1-like [54229] (11 protein domains)
  6. 2157730Protein Ribonuclease PH, domain 1 [102758] (4 species)
  7. 2157738Species Bacillus subtilis [TaxId:1423] [102761] (3 PDB entries)
  8. 2157741Domain d1oypb1: 1oyp B:1-151 [93736]
    Other proteins in same PDB: d1oypa2, d1oypb2, d1oypc2, d1oypd2, d1oype2, d1oypf2
    complexed with so4

Details for d1oypb1

PDB Entry: 1oyp (more details), 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis
PDB Compounds: (B:) Ribonuclease PH

SCOPe Domain Sequences for d1oypb1:

Sequence, based on SEQRES records: (download)

>d1oypb1 d.14.1.4 (B:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlpratnqrtiresskgkisgrtmeiqrligralravvdleklgertiwidcdviq
adggtrtasitgaflamaiaigklikagtik

Sequence, based on observed residues (ATOM records): (download)

>d1oypb1 d.14.1.4 (B:1-151) Ribonuclease PH, domain 1 {Bacillus subtilis [TaxId: 1423]}
mrhdgrqhdelrpitfdldfishpegsvlitagntkvicnasvedrvppflrgggkgwit
aeysmlsgrtmeiqrligralravvdleklgertiwidcdviqadggtrtasitgaflam
aiaigklikagtik

SCOPe Domain Coordinates for d1oypb1:

Click to download the PDB-style file with coordinates for d1oypb1.
(The format of our PDB-style files is described here.)

Timeline for d1oypb1: