SCOPe 2.08: Domain d1oype2: 1oyp E:152-243

Lineage for d1oype2 (1oyp E:152-243)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134

4. Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families)

5. Family d.101.1.1: Ribonuclease PH domain 2-like [55667] (11 proteins)

6. Protein Ribonuclease PH, domain 2 [103150] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [103153] (3 PDB entries)

8. Domain d1oype2: 1oyp E:152-243 [93743]
   Other proteins in same PDB: d1oypa1, d1oypb1, d1oypc1, d1oypd1, d1oype1, d1oypf1
   complexed with so4

Details for d1oype2

PDB Entry: 1oyp, 2.76 Å

PDB Description: Crystal Structure of the phosphorolytic exoribonuclease RNase PH from Bacillus subtilis

PDB Compounds: (E:) Ribonuclease PH

SCOPe Domain Sequences for d1oype2:

Sequence; same for both SEQRES and ATOM records:

>d1oype2 d.101.1.1 (E:152-243) Ribonuclease PH, domain 2 {Bacillus subtilis [TaxId: 1423]}
tnpitdflaaisvgidkeqgilldlnyeedssaevdmnvimtgsgrfvelqgtgeeatfs
redlngllglaekgiqelidkqkevlgdslpe

Timeline for d1oype2:

• d1oype2 first appeared in SCOP 1.67
  
• d1oype2 appears in SCOPe 2.07