SCOPe 2.01: Domain d1ow8c_: 1ow8 C:

Lineage for d1ow8c_ (1ow8 C:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families)

5. Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)

6. Protein FAT domain of focal adhesion kinase [68995] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [68996] (5 PDB entries)

8. Domain d1ow8c_: 1ow8 C: [93639]
   complexed with paxillin ld2 motif, chains D and F

Details for d1ow8c_

PDB Entry: 1ow8, 2.85 Å

PDB Description: Paxillin LD2 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase

PDB Compounds: (C:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1ow8c_:

Sequence; same for both SEQRES and ATOM records:

>d1ow8c_ a.24.14.1 (C:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
pqeisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtll
atvdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaah
alavdaknlldvidqarlkmlg

Timeline for d1ow8c_:

• d1ow8c_ first appeared in SCOP 1.67
  
• d1ow8c_ appears in SCOP 1.75
  
• d1ow8c_ appears in SCOPe 2.02
  
• d1ow8c_ appears in the current release, SCOPe 2.08