Lineage for d1ow8c_ (1ow8 C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 765368Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 765756Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (1 family) (S)
  5. 765757Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (1 protein)
  6. 765758Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 765763Species Human (Homo sapiens) [TaxId:9606] [68996] (7 PDB entries)
  8. 765777Domain d1ow8c_: 1ow8 C: [93639]
    complexed with paxillin ld2 motif, chains D and F

Details for d1ow8c_

PDB Entry: 1ow8 (more details), 2.85 Å

PDB Description: Paxillin LD2 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase
PDB Compounds: (C:) Focal adhesion kinase 1

SCOP Domain Sequences for d1ow8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow8c_ a.24.14.1 (C:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
pqeisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtll
atvdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaah
alavdaknlldvidqarlkmlg

SCOP Domain Coordinates for d1ow8c_:

Click to download the PDB-style file with coordinates for d1ow8c_.
(The format of our PDB-style files is described here.)

Timeline for d1ow8c_: