Lineage for d1ow8c_ (1ow8 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312054Superfamily a.24.14: FAT domain of focal adhesion kinase [68993] (2 families) (S)
  5. 2312055Family a.24.14.1: FAT domain of focal adhesion kinase [68994] (2 proteins)
    automatically mapped to Pfam PF03623
  6. 2312056Protein FAT domain of focal adhesion kinase [68995] (3 species)
  7. 2312061Species Human (Homo sapiens) [TaxId:9606] [68996] (5 PDB entries)
  8. 2312074Domain d1ow8c_: 1ow8 C: [93639]
    complexed with paxillin ld2 motif, chains D and F

Details for d1ow8c_

PDB Entry: 1ow8 (more details), 2.85 Å

PDB Description: Paxillin LD2 motif bound to the Focal Adhesion Targeting (FAT) domain of the Focal Adhesion Kinase
PDB Compounds: (C:) Focal adhesion kinase 1

SCOPe Domain Sequences for d1ow8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow8c_ a.24.14.1 (C:) FAT domain of focal adhesion kinase {Human (Homo sapiens) [TaxId: 9606]}
pqeisppptanldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtll
atvdetipllpasthreiemaqkllnsdlgelinkmklaqqyvmtslqqeykkqmltaah
alavdaknlldvidqarlkmlg

SCOPe Domain Coordinates for d1ow8c_:

Click to download the PDB-style file with coordinates for d1ow8c_.
(The format of our PDB-style files is described here.)

Timeline for d1ow8c_: