![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (2 families) ![]() |
![]() | Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
![]() | Protein Cre recombinase [47825] (1 species) |
![]() | Species Bacteriophage P1 [TaxId:10678] [47826] (20 PDB entries) Uniprot P06956 20-341 |
![]() | Domain d1ouqf1: 1ouq F:20-129 [93563] Other proteins in same PDB: d1ouqa2, d1ouqb2, d1ouqe2, d1ouqf2 protein/DNA complex; complexed with iod, mg |
PDB Entry: 1ouq (more details), 3.2 Å
SCOPe Domain Sequences for d1ouqf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouqf1 a.60.9.1 (F:20-129) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1ouqf1: