PDB entry 1ouq

View 1ouq on RCSB PDB site
Description: Crystal structure of wild-type Cre recombinase-loxP synapse
Class: replication/DNA
Keywords: Cre, recombinase, DNA, REPLICATION/DNA COMPLEX
Deposited on 2003-03-25, released 2003-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.21
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ouqa1, d1ouqa2
  • Chain 'B':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ouqb1, d1ouqb2
  • Chain 'C':
    Compound: LoxP DNA
  • Chain 'D':
    Compound: LoxP DNA
  • Chain 'E':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ouqe1, d1ouqe2
  • Chain 'F':
    Compound: cre recombinase
    Species: Enterobacteria phage P1 [TaxId:10678]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ouqf1, d1ouqf2
  • Chain 'G':
    Compound: LoxP DNA
  • Chain 'H':
    Compound: LoxP DNA
  • Chain 'X':
    Compound: LoxP DNA
  • Chain 'Y':
    Compound: LoxP DNA
  • Heterogens: MG, IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ouqA (A:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouqA (A:)
    nlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepe
    dvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
    rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
    ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
    psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
    mqaggwtnvnivmnyirnldsetgamvrlled
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ouqB (B:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouqB (B:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ouqE (E:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouqE (E:)
    devrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylqa
    rglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafert
    dfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigrt
    ktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstra
    legifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvni
    vmnyirnldsetgamvrlled
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ouqF (F:)
    msnlltvhqnlpalpvdatsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnn
    rkwfpaepedvrdyllylqarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrri
    rkenvdagerakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiari
    rvkdisrtdggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfc
    rvrkngvaapsatsqlstralegifeathrliygakddsgqrylawsghsarvgaardma
    ragvsipeimqaggwtnvnivmnyirnldsetgamvrlledgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ouqF (F:)
    sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
    arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdagerakqalafer
    tdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtdggrmlihigr
    tktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstr
    alegifeathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtnvn
    ivmnyirnldsetgamvrlled
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.