![]() | Class a: All alpha proteins [46456] (202 folds) |
![]() | Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) ![]() |
![]() | Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) |
![]() | Protein Cre recombinase [47825] (1 species) |
![]() | Species Bacteriophage P1 [TaxId:10678] [47826] (16 PDB entries) |
![]() | Domain d1ouqe1: 1ouq E:21-129 [93561] Other proteins in same PDB: d1ouqa2, d1ouqb2, d1ouqe2, d1ouqf2 |
PDB Entry: 1ouq (more details), 3.2 Å
SCOP Domain Sequences for d1ouqe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouqe1 a.60.9.1 (E:21-129) Cre recombinase {Bacteriophage P1} devrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylqa rglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1ouqe1: