![]() | Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
![]() | Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
![]() | Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
![]() | Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins) |
![]() | Protein Cre recombinase [56355] (1 species) |
![]() | Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries) |
![]() | Domain d1ouqb2: 1ouq B:130-341 [93560] Other proteins in same PDB: d1ouqa1, d1ouqb1, d1ouqe1, d1ouqf1 |
PDB Entry: 1ouq (more details), 3.2 Å
SCOP Domain Sequences for d1ouqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ouqb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d1ouqb2: