SCOP 1.67: Domain d1ouqf2: 1ouq F:130-341

Lineage for d1ouqf2 (1ouq F:130-341)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries)

8. Domain d1ouqf2: 1ouq F:130-341 [93564]
   Other proteins in same PDB: d1ouqa1, d1ouqb1, d1ouqe1, d1ouqf1
   complexed with a3p, iod, mg, ump

Details for d1ouqf2

PDB Entry: 1ouq, 3.2 Å

PDB Description: Crystal structure of wild-type Cre recombinase-loxP synapse

SCOP Domain Sequences for d1ouqf2:

Sequence; same for both SEQRES and ATOM records:

>d1ouqf2 d.163.1.1 (F:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d1ouqf2:

• d1ouqf2 is new in SCOP 1.67
  
• d1ouqf2 appears in SCOP 1.69
  
• d1ouqf2 appears in the current release, SCOPe 2.08