SCOPe 2.05: Domain d1op1a_: 1op1 A:

Lineage for d1op1a_ (1op1 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.13: RAP domain-like [47044] (1 superfamily)
   3 helices, the first one is shorter than the other two; bundle, partly opened

4. Superfamily a.13.1: RAP domain-like [47045] (1 family)

5. Family a.13.1.1: RAP domain [47046] (1 protein)

6. Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)

8. Domain d1op1a_: 1op1 A: [93396]

Details for d1op1a_

PDB Entry: 1op1

PDB Description: solution nmr structure of domain 1 of receptor associated protein

PDB Compounds: (A:) Alpha-2-macroglobulin receptor-associated protein precursor

SCOPe Domain Sequences for d1op1a_:

Sequence; same for both SEQRES and ATOM records:

>d1op1a_ a.13.1.1 (A:) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdarq

Timeline for d1op1a_:

• d1op1a_ first appeared in SCOP 1.67
  
• d1op1a_ appears in SCOPe 2.04
  
• d1op1a_ appears in SCOPe 2.06
  
• d1op1a_ appears in the current release, SCOPe 2.08