Lineage for d1op1a_ (1op1 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352899Fold a.13: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47044] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, partly opened
  4. 352900Superfamily a.13.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47045] (1 family) (S)
  5. 352901Family a.13.1.1: alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47046] (1 protein)
  6. 352902Protein alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 [47047] (1 species)
  7. 352903Species Human (Homo sapiens) [TaxId:9606] [47048] (4 PDB entries)
  8. 352906Domain d1op1a_: 1op1 A: [93396]

Details for d1op1a_

PDB Entry: 1op1 (more details)

PDB Description: solution nmr structure of domain 1 of receptor associated protein

SCOP Domain Sequences for d1op1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op1a_ a.13.1.1 (A:) alpha-2-Macroglobulin receptor associated protein (RAP) domain 1 {Human (Homo sapiens)}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdarq

SCOP Domain Coordinates for d1op1a_:

Click to download the PDB-style file with coordinates for d1op1a_.
(The format of our PDB-style files is described here.)

Timeline for d1op1a_: