Lineage for d1op1a_ (1op1 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697661Fold a.13: RAP domain-like [47044] (1 superfamily)
    3 helices, the first one is shorter than the other two; bundle, partly opened
  4. 2697662Superfamily a.13.1: RAP domain-like [47045] (1 family) (S)
  5. 2697663Family a.13.1.1: RAP domain [47046] (1 protein)
  6. 2697664Protein alpha-2-Macroglobulin receptor associated protein (RAP) [47047] (1 species)
  7. 2697665Species Human (Homo sapiens) [TaxId:9606] [47048] (7 PDB entries)
  8. 2697668Domain d1op1a_: 1op1 A: [93396]

Details for d1op1a_

PDB Entry: 1op1 (more details)

PDB Description: solution nmr structure of domain 1 of receptor associated protein
PDB Compounds: (A:) Alpha-2-macroglobulin receptor-associated protein precursor

SCOPe Domain Sequences for d1op1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1op1a_ a.13.1.1 (A:) alpha-2-Macroglobulin receptor associated protein (RAP) {Human (Homo sapiens) [TaxId: 9606]}
geefrmeklnqlwekaqrlhlppvrlaelhadlkiqerdelawkklkldgldedgekear
lirnlnvilakygldgkkdarq

SCOPe Domain Coordinates for d1op1a_:

Click to download the PDB-style file with coordinates for d1op1a_.
(The format of our PDB-style files is described here.)

Timeline for d1op1a_: