SCOP 1.67: Domain d1okrb_: 1okr B:

Lineage for d1okrb_ (1okr B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (45 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (2 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain

6. Protein Methicillin resistance regulatory protein MecI [101017] (1 species)

7. Species Staphyloccocus aureus [101018] (4 PDB entries)

8. Domain d1okrb_: 1okr B: [93270]
   complexed with cl, gol

Details for d1okrb_

PDB Entry: 1okr, 2.4 Å

PDB Description: three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci.

SCOP Domain Sequences for d1okrb_:

Sequence; same for both SEQRES and ATOM records:

>d1okrb_ a.4.5.39 (B:) Methicillin resistance regulatory protein MecI {Staphyloccocus aureus}
mdnktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidr
kkdnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnil
nkk

Timeline for d1okrb_:

• d1okrb_ is new in SCOP 1.67
  
• d1okrb_ appears in SCOP 1.69
  
• d1okrb_ appears in the current release, SCOPe 2.08