Lineage for d1okrb_ (1okr B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. Protein Methicillin resistance regulatory protein MecI [101017] (1 species)
  7. Species Staphylococcus aureus [TaxId:1280] [101018] (5 PDB entries)
  8. Domain d1okrb_: 1okr B: [93270]
    complexed with cl, gol

Details for d1okrb_

PDB Entry: 1okr (more details), 2.4 Å

PDB Description: three-dimensional structure of s.aureus methicillin-resistance regulating transcriptional repressor meci.
PDB Compounds: (B:) Methicillin resistance regulatory protein mecI

SCOPe Domain Sequences for d1okrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okrb_ a.4.5.39 (B:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]}
mdnktyeissaewevmniiwmkkyasanniieeiqmqkdwspktirtlitrlykkgfidr
kkdnkifqyyslveesdikyktsknfinkvykggfnslvlnfvekedlsqdeieelrnil
nkk

SCOPe Domain Coordinates for d1okrb_ are not available.

Timeline for d1okrb_:

Domains from other chains:
(mouse over for more information)
d1okra_