SCOPe 2.02: Domain d1ojja_: 1ojj A:

Lineage for d1ojja_ (1ojj A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
   contains many insertions in the common fold

6. Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)

7. Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)

8. Domain d1ojja_: 1ojj A: [93130]
   complexed with nag; mutant

Details for d1ojja_

PDB Entry: 1ojj, 1.4 Å

PDB Description: anatomy of glycosynthesis: structure and kinetics of the humicola insolens cel7be197a and e197s glycosynthase mutants

PDB Compounds: (A:) endoglucanase I

SCOPe Domain Sequences for d1ojja_:

Sequence; same for both SEQRES and ATOM records:

>d1ojja_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b [TaxId: 34413]}
ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnsmdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigstyq

Timeline for d1ojja_:

• d1ojja_ first appeared in SCOP 1.67
  
• d1ojja_ appears in SCOPe 2.01
  
• d1ojja_ appears in SCOPe 2.03
  
• d1ojja_ appears in the current release, SCOPe 2.08