Lineage for d1ojja_ (1ojj A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 371122Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 371123Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families) (S)
  5. 371784Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (1 protein)
    contains many insertions in the common fold
  6. 371785Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (5 species)
  7. 371799Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)
  8. 371800Domain d1ojja_: 1ojj A: [93130]

Details for d1ojja_

PDB Entry: 1ojj (more details), 1.4 Å

PDB Description: anatomy of glycosynthesis: structure and kinetics of the humicola insolens cel7be197a and e197s glycosynthase mutants

SCOP Domain Sequences for d1ojja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojja_ b.29.1.10 (A:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b}
ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnsmdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigstyq

SCOP Domain Coordinates for d1ojja_:

Click to download the PDB-style file with coordinates for d1ojja_.
(The format of our PDB-style files is described here.)

Timeline for d1ojja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ojjb_