Lineage for d1ojjb_ (1ojj B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119246Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
  6. 1119247Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (6 species)
  7. 1119264Species Humicola insolens, Cel7b [TaxId:34413] [49977] (6 PDB entries)
  8. 1119266Domain d1ojjb_: 1ojj B: [93131]
    complexed with nag; mutant

Details for d1ojjb_

PDB Entry: 1ojj (more details), 1.4 Å

PDB Description: anatomy of glycosynthesis: structure and kinetics of the humicola insolens cel7be197a and e197s glycosynthase mutants
PDB Compounds: (B:) endoglucanase I

SCOPe Domain Sequences for d1ojjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ojjb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Humicola insolens, Cel7b [TaxId: 34413]}
ekpgetkevhpqlttfrctkrggckpatnfivldslshpihraeglgpggcgdwgnpppk
dvcpdvescakncimegipdysqygvttngtslrlqhilpdgrvpsprvylldktkrrye
mlhltgfeftfdvdatklpcgmnsalylsemhptgakskynpggayygtgycdaqcfvtp
finglgniegkgsccnsmdiweansrashvaphtcnkkglylcegeecafegvcdkngcg
wnnyrvnvtdyygrgeefkvntlkpftvvtqflanrrgklekihrfyvqdgkviesfytn
kegvpytnmiddefceatgsrkymelgatqgmgealtrgmvlamsiwwdqggnmewldhg
eagpcakgegapsnivqvepfpevtytnlrwgeigstyq

SCOPe Domain Coordinates for d1ojjb_:

Click to download the PDB-style file with coordinates for d1ojjb_.
(The format of our PDB-style files is described here.)

Timeline for d1ojjb_: