SCOPe 2.08: Domain d1ogta2: 1ogt A:1-181

Lineage for d1ogta2 (1ogt A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B27 [TaxId:9606] [54471] (9 PDB entries)
   Uniprot P03989 25-300

8. Domain d1ogta2: 1ogt A:1-181 [92940]
   Other proteins in same PDB: d1ogta1, d1ogtb1, d1ogtb2
   complexed with gol, mn

Details for d1ogta2

PDB Entry: 1ogt, 1.47 Å

PDB Description: crystal structure of hla-b*2705 complexed with the vasoactive intestinal peptide type 1 receptor (vipr) peptide (residues 400-408)

PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1ogta2:

Sequence; same for both SEQRES and ATOM records:

>d1ogta2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B27 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d1ogta2:

• d1ogta2 first appeared in SCOP 1.67
  
• d1ogta2 appears in SCOPe 2.07